PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0161s0052.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 448aa    MW: 49254 Da    PI: 6.6572
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0161s0052.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.21.7e-2847103259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           Dgy+WrKYGqK+vkg++f rsYYrCt+++C+vkk+vers+ +++++++   g+H+h+
  Kalax.0161s0052.1.p  47 ADGYSWRKYGQKHVKGNKFVRSYYRCTHPDCQVKKQVERSH-NGQITDTLVFGDHDHP 103
                          6****************************************.***************8 PP

2WRKY105.13.6e-33221279159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ++Dgy+WrKYGqK vkg+++prsYYrC++agCpvkk+ver+++d kvv++tYeg+H+h+
  Kalax.0161s0052.1.p 221 VNDGYRWRKYGQKFVKGNPNPRSYYRCSTAGCPVKKHVERASHDAKVVITTYEGQHDHD 279
                          58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-2444104IPR003657WRKY domain
SMARTSM007746.8E-3046104IPR003657WRKY domain
SuperFamilySSF1182902.09E-2246104IPR003657WRKY domain
PfamPF031063.8E-2248103IPR003657WRKY domain
PROSITE profilePS5081119.41648105IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-35208281IPR003657WRKY domain
SuperFamilySSF1182902.35E-29213281IPR003657WRKY domain
PROSITE profilePS5081135.886216281IPR003657WRKY domain
SMARTSM007743.6E-38221280IPR003657WRKY domain
PfamPF031063.0E-26222278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MVATEESMRG EIVSKLEKSN SPESGILVLR SDQEGGMPLV TPEKGPADGY SWRKYGQKHV  60
KGNKFVRSYY RCTHPDCQVK KQVERSHNGQ ITDTLVFGDH DHPRTQLRLP VTVNSTIVAK  120
EGVIDMPCPV LSEEKTPVAV HQAPKPTDHK ETPMPPTVAE PDLQEHVVAQ STKTKDNLGK  180
DCTPDLKRQK KEPLHPEAAI TDKPTMDPRL VLQTVSEVDM VNDGYRWRKY GQKFVKGNPN  240
PRSYYRCSTA GCPVKKHVER ASHDAKVVIT TYEGQHDHDM PPARMMSNST SGNSTNQFLG  300
LEYNPGVRSN ESHHKCKPKD QLNREPKIES EEAEKVVNQL GSLSSSGPES KMSDQISGKS  360
ADNLEAVESC GVTDVAVSTN PAEGFNTDGQ EVTKARASPG LAADGLKAEE DSELRNDEAI  420
KQETSEGVRR NLDHGSPTAA TLRDPHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-3648283276WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015869324.11e-108PREDICTED: WRKY transcription factor 1-like
RefseqXP_015881045.11e-108PREDICTED: WRKY transcription factor 1
SwissprotQ9SI371e-76WRKY1_ARATH; WRKY transcription factor 1
TrEMBLF6HHL81e-105F6HHL8_VITVI; Putative uncharacterized protein
STRINGVIT_12s0057g00550.t011e-105(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-79zinc-dependent activator protein-1